Nymphalis io (European peacock): 126770663 Help Entry 126770663         CDS       T08495                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism niq  Nymphalis io (European peacock) Pathway niq04013   MAPK signaling pathway - fly niq04145   Phagosome niq04148   Efferocytosis niq04310   Wnt signaling pathway niq04620   Toll-like receptor signaling pathway niq05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:niq00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126770663    04310 Wnt signaling pathway     126770663  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126770663    04148 Efferocytosis     126770663  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126770663  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126770663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:niq04131]     126770663   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:niq04147]     126770663    04031 GTP-binding proteins [BR:niq04031]     126770663 Membrane trafficking [BR:niq04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126770663  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126770663   Macropinocytosis    Ras GTPases     126770663  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126770663 Exosome [BR:niq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126770663   Exosomal proteins of other body fluids (saliva and urine)    126770663   Exosomal proteins of colorectal cancer cells    126770663   Exosomal proteins of bladder cancer cells    126770663 GTP-binding proteins [BR:niq04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126770663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  126770663 NCBI-ProteinID:  XP_050346129 LinkDB All DBs Position 9:10385376..10429051 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPIKVKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaagtgtgtcgttgtaggtgacggtgccgtcggtaagacatgtctactc atcagttacacgacaaatgcctttcccggggagtacataccaacagtattcgacaattac tcggcgaatgtaatggttgatggcaagccgattaacctgggtctatgggatacggcgggt caggaggactacgacaggctgcgacctctctcttacccacagactgacgtgttcctcata tgcttctccctcgttaacccggcatccttcgagaacgttcgcgcaaagtggtacccagaa gttcggcatcactgcccatcgacgcccatcatcctcgttggaacgaagctcgatctccgc gaagacaaggacaccattgaaaagctcaaggacaaaaaactcgcacccatcacttatcca cagggtctgagcatggcgaaggagatcggtgccgtgaagtacctggaatgctccgcgctg acgcagaaaggactcaagacggtgtttgacgaagcgatccgcgctgtcctctgccccgtc cagccgatcaaggtgaagcggaagtgcgtgctactgtaa

DBGET integrated database retrieval system