Nymphalis io (European peacock): 126772921 Help Entry 126772921         CDS       T08495                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism niq  Nymphalis io (European peacock) Pathway niq04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:niq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126772921  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:niq04121]     126772921    03400 DNA repair and recombination proteins [BR:niq03400]     126772921 Ubiquitin system [BR:niq04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126772921    Cul5 complex      126772921 DNA repair and recombination proteins [BR:niq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126772921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  126772921 NCBI-ProteinID:  XP_050349479 LinkDB All DBs Position 13:11749272..11756982 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFETMELTPYSTPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaaattgaccatcttcacagatgcgaaggat actacgactgttttagaattgaagaaaatgatagaaggtatcctgaaagtaccaccccca agtcagatgcttttcaacaaggacagtcagctaatggaagatgaaaagaccctcgcagaa tatggactaacttcggccacagctaaagctcagtgccctgctccgattggattggcttta agaaaagaaaatggtgaatttgagacaatggaactgacaccctactctacaccacctgat ctacctgatgtaatgaaatctcaggagaccaacggacaggaacagatggatcagcactaa

DBGET integrated database retrieval system