Nymphalis io (European peacock): 126779293 Help Entry 126779293         CDS       T08495                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism niq  Nymphalis io (European peacock) Pathway niq04137   Mitophagy - animal niq04140   Autophagy - animal niq04144   Endocytosis niq04145   Phagosome niq04148   Efferocytosis Brite KEGG Orthology (KO) [BR:niq00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126779293    04145 Phagosome     126779293    04140 Autophagy - animal     126779293    04137 Mitophagy - animal     126779293    04148 Efferocytosis     126779293  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:niq04131]     126779293   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:niq04147]     126779293    04031 GTP-binding proteins [BR:niq04031]     126779293 Membrane trafficking [BR:niq04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     126779293 Exosome [BR:niq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126779293   Exosomal proteins of other body fluids (saliva and urine)    126779293   Exosomal proteins of colorectal cancer cells    126779293   Exosomal proteins of bladder cancer cells    126779293 GTP-binding proteins [BR:niq04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     126779293 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 AAA_24 PduV-EutP AAA_22 NACHT AAA_7 AAA_5 ATPase_2 G-alpha NTPase_1 SRPRB ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK DAP3 Motif Other DBs NCBI-GeneID:  126779293 NCBI-ProteinID:  XP_050359247 LinkDB All DBs Position 2:6022676..6025527 Genome browser AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPENFPF VILGNKVDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaagaaaaaaggttcttttaaaagttatcatcctaggcgacagtggcgttggt aaaacatcattgatgaatcagtttgtcaataaaaaattttccaaccagtacaaggcgaca ataggcgctgattttctcacgaaagaggtaattgtcgatgaccgtatcgtcacaatgcag atctgggacacagcaggacaagagcgattccaatcactaggggtggcgttttatcgtggg gcggattgttgcgtcttagtttttgacgtaactgcccccaacacgtttaagtccttggag agttggagagacgaatttttgatacaagcatctccacgcgatccggaaaactttccattt gttatactaggtaataaagttgatttggataatcgtgctgtatctgccaaacgagcccag caatggtgtcaaagtaaaaatgatatcccttatttcgaaacaagtgccaaagaagctgtg aatgtcgaacttgcgtttcagacaatagcacgcaatgcgttggcgcaagagacagaagca gagctgtacaatgagttccctgatcaaatcaagctgaatgctaatgataatggtcgcaac agggatggagataactgtgcttgctaa

DBGET integrated database retrieval system