Nitratiruptor sp. SB155-2: NIS_0255 Help Entry NIS_0255          CDS       T00565                                  Symbol panD Name (GenBank) aspartate decarboxylase   KO K01579   aspartate 1-decarboxylase [EC:4.1.1.11] Organism nis  Nitratiruptor sp. SB155-2 Pathway nis00410   beta-Alanine metabolism nis00770   Pantothenate and CoA biosynthesis nis01100   Metabolic pathways nis01110   Biosynthesis of secondary metabolites nis01240   Biosynthesis of cofactors Module nis_M00119   Pantothenate biosynthesis, valine/L-aspartate => pantothenate Brite KEGG Orthology (KO) [BR:nis00001]  09100 Metabolism   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     NIS_0255 (panD)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     NIS_0255 (panD) Enzymes [BR:nis01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.11  aspartate 1-decarboxylase      NIS_0255 (panD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_decarbox PUA_4 Motif Other DBs NCBI-ProteinID:  BAF69369 UniProt:  A6Q1L0 LinkDB All DBs Position 243227..243592 Genome browser AA seq 121 aa AA seqDB search MQIEMLYSKIHRATVTDADLNYVGSITIDEELMEAAKLRVGQKVEILNINNGERFQTYVI KGERGKRDICLNGAAARKAHPGDKIIIVAYALFDESELENYEPTVVLVNDENDIEEIISY M NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcaaatagagatgctctatagcaaaattcatcgagctactgtaacggatgccgacttg aactatgtcggctccattacaatcgatgaagagctcatggaagctgcaaagcttcgtgta gggcaaaaagtggagatactcaatatcaacaatggtgaacgttttcaaacctatgttatc aaaggggagcgcggaaagcgagatatctgtctcaatggagctgctgcaagaaaagcgcat cctggagacaaaattatcatagtagcctatgctctttttgatgagagtgaattggaaaat tatgagccaacagtcgttttagtaaacgacgagaatgatatagaagagattatctcttat atgtaa

DBGET integrated database retrieval system