KEGG   Nitratiruptor sp. SB155-2: NIS_0820
Entry
NIS_0820          CDS       T00565                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00770  Pantothenate and CoA biosynthesis
nis01100  Metabolic pathways
nis01240  Biosynthesis of cofactors
Module
nis_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NIS_0820 (coaD)
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     NIS_0820 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig L544_helical
Other DBs
NCBI-ProteinID: BAF69932
LinkDB
Position
complement(824373..824843)
AA seq 156 aa
MRKVIYPGTFDPITNGHLDIIKRASTIFDHVIVAVARSQEKKPMFDITTRVKMAHIATSD
MPNVTIKEFDTLLVNFCKQEDAFIIIRGLRAVSDFEYELQMGYANRSLDKDIETLYLMPS
LQNAFISSSVVRTILKYKGNVSHLVPQSIIPYLESR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcgtaaagtcatctatcccggtacttttgaccctatcacaaatggacatctggatatc
ataaaaagagcaagcactatttttgaccacgtcatagtagccgtagctcgctcgcaagag
aaaaaaccgatgttcgatataacgactagggtgaaaatggctcatattgccacatccgat
atgccgaatgtcactatcaaagagtttgatacactcttggtcaatttttgtaagcaagaa
gatgcctttattatcatacgaggtcttagggctgtgagtgattttgaatatgaactacaa
atgggatatgccaatcgatctttggataaagatatcgaaacactctatctcatgccgagc
ttgcaaaatgcgttcatcagttcaagcgtggtacggacgattctcaaatacaaaggaaac
gtctcacatctggtaccacaatctattattccttatctggagagccgttaa

DBGET integrated database retrieval system