Nitrosomonas sp. AL212: NAL212_0671 Help Entry NAL212_0671       CDS       T01443                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nit  Nitrosomonas sp. AL212 Pathway nit01100   Metabolic pathways nit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NAL212_0671    00074 Mycolic acid biosynthesis     NAL212_0671   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NAL212_0671 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  ADZ25609 UniProt:  F9ZEA5 LinkDB All DBs Position 551938..552180 Genome browser AA seq 80 aa AA seqDB search MENIEQRIKKIVAEQLGVNEAEVKNESSFVNDLGADSLDTVELVMALEEEFECEIPDEQA EKINTVQEAIDYVTANTSVG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaaatattgagcagcgtattaaaaagattgtagctgaacaacttggtgttaatgag gcagaagtcaagaacgaatcatcttttgttaatgatctaggtgcagattcgctcgacacg gtggagttggtcatggcgttggaggaagaattcgaatgcgagatcccggacgagcaagct gaaaaaataaataccgtccaagaagcgattgattacgtcaccgctaacacgagtgtcggt tag

DBGET integrated database retrieval system