Candidatus Nitrosotenuis sp. DW1: DSQ19_02735 Help Entry DSQ19_02735       CDS       T07741                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism niu  Candidatus Nitrosotenuis sp. DW1 Pathway niu03010   Ribosome Brite KEGG Orthology (KO) [BR:niu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DSQ19_02735   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DSQ19_02735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:niu03011]     DSQ19_02735    04121 Ubiquitin system [BR:niu04121]     DSQ19_02735   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:niu04147]     DSQ19_02735 Ribosome [BR:niu03011]  Ribosomal proteins   Eukaryotes    Small subunit     DSQ19_02735   Archaea     DSQ19_02735 Ubiquitin system [BR:niu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DSQ19_02735 Exosome [BR:niu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DSQ19_02735   Exosomal proteins of colorectal cancer cells    DSQ19_02735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e DUF1451 Zn_ribbon_NUD DUF7630 DZR_2 Zf_2nd_IFT121 Baculo_LEF5_C DZR Motif Other DBs NCBI-ProteinID:  QLH08539 LinkDB All DBs Position complement(479066..479248) Genome browser AA seq 60 aa AA seqDB search MAGKKAAAKASDSIHKYYKISGDKITRLHRLCSRCGKGVFMSEHKNRRTCGKCGLTEFNQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcaggaaaaaaagcggcagcaaaggcatctgattcaatccacaaatactacaagata agtggagacaagataacaaggcttcacagactgtgttctagatgtggcaaaggtgtcttt atgtcagagcacaaaaacaggcgcacgtgcggcaagtgcggcctcactgaatttaatcag tag

DBGET integrated database retrieval system