Niveibacterium microcysteis: JY500_05820 Help Entry JY500_05820       CDS       T07082                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism niv  Niveibacterium microcysteis Pathway niv01100   Metabolic pathways niv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:niv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JY500_05820    00074 Mycolic acid biosynthesis     JY500_05820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JY500_05820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSI78157 LinkDB All DBs Position 1259393..1259641 Genome browser AA seq 82 aa AA seqDB search MDIRKELAAILDELLSLGGRAAAFDDATPLLGALPELDSMAVVGVIGAIEERFGLVFDDD EIDGTSFASFGSLAKLIDAKLS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt ttggatattcgcaaggaacttgcagccattcttgatgagctgctgagtctgggtggccgc gctgcggcctttgatgacgcgacgcccttgctgggggccttgcccgagctcgactcgatg gcagtggttggcgtgatcggcgcgatcgaagagcgttttgggctggtcttcgacgacgac gagattgatggcacctcgttcgccagttttgggagcctcgccaagttgatcgacgcgaaa ctgtcgtga

DBGET integrated database retrieval system