Niveibacterium microcysteis: JY500_15275 Help Entry JY500_15275       CDS       T07082                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism niv  Niveibacterium microcysteis Pathway niv01100   Metabolic pathways niv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:niv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JY500_15275    00074 Mycolic acid biosynthesis     JY500_15275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JY500_15275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSI75833 LinkDB All DBs Position complement(3375664..3375936) Genome browser AA seq 90 aa AA seqDB search MSTNELTVALKRLIVDTCEKDLPPEALSDDEPIFGPQARLALDSLDALQLSMALQKRYGV RLTDSKETRRILASVASLADYLQDKAPRLT NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaatgaactgaccgtggcgctcaagcgcctgatcgtcgacacctgcgagaag gacttgccgccggaagccttgagcgatgatgaaccgatcttcggcccgcaggcgcgcctg gcgctcgattcgctcgatgcgctgcagctttcgatggcgctgcagaagcgctatggggtt cggctgaccgatagcaaggagactcggcgcattctcgcgagtgtggcatcgcttgccgac tacctgcaggacaaggctccgcgcctgacatga

DBGET integrated database retrieval system