KEGG   Nitratireductor mangrovi: FQ775_09865
Entry
FQ775_09865       CDS       T06518                                 
Name
(GenBank) HMP/thiamine-binding protein
  KO
K24620  energy-coupling factor transport system substrate-specific component
Organism
niy  Nitratireductor mangrovi
Brite
KEGG Orthology (KO) [BR:niy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:niy02000]
    FQ775_09865
Transporters [BR:niy02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    FQ775_09865
SSDB
Motif
Pfam: Ykof Thiamine_BP
Other DBs
NCBI-ProteinID: QDZ00662
UniProt: A0A5B8KYL3
LinkDB
Position
4520483..4521091
AA seq 202 aa
MFSGAQLSIYPMSDNFVGIILGALSTLDPYRDHLRIETDDISTLIVGPPEQLFPAMRDLF
VAASGGGIHCVLSAAVSRGCPGEPDDPACTPSEGVGNDRPLAERIVGAREAVANSAITGR
PVAAQFSLYPLGGAHHMDEIYGCIDFLKASGVFDRSKNFCTKLRGDAGPVFATLAEAFLR
FGAPDGHVALDVTVSANSPSAA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgttttccggcgcacagctgtccatctatccgatgtccgacaatttcgtcggcatcatc
ctcggcgcgctttccacgctcgatccctaccgcgaccacctgcgcatcgagaccgacgac
atctcgacgctgatcgtcggcccgcccgaacaactgttcccggcgatgcgcgacctgttc
gtggcggcaagcggcggcggcatccattgcgtgctctccgctgccgtctcgcgcggctgt
cccggcgagcccgacgatcccgcctgcaccccgtccgaaggggtcggcaacgaccggccg
ctcgccgagcgtattgtcggcgcgcgcgaggcggtcgccaattccgccatcaccggccgt
cccgtcgccgcgcagttctcgctctacccgctcggcggcgcacaccacatggacgagatc
tacggctgcatcgatttcctcaaggcatccggcgtcttcgaccgttcgaagaacttttgc
accaagctgcgcggcgacgccggtccggtcttcgccaccctggccgaagctttcctgcgc
ttcggcgcgccggacggtcacgtggcgctcgacgtcacggtctcggccaacagcccgagc
gcggcctga

DBGET integrated database retrieval system