Nitratireductor mangrovi: FQ775_11830 Help Entry FQ775_11830       CDS       T06518                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism niy  Nitratireductor mangrovi Pathway niy01100   Metabolic pathways niy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:niy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FQ775_11830    00074 Mycolic acid biosynthesis     FQ775_11830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FQ775_11830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QDZ01016 UniProt:  A0A5B8KZK5 LinkDB All DBs Position 684026..684262 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIEKAAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgcagagcgcgtcaaaaaaatcgttgtagagcatctcggcgttgacgcc gacaaggtcaccgagggcgcgagcttcatcgacgatctgggcgcggacagtctggacacc gtcgaactcgtcatggccttcgaggaagagttcggtgtcgagatcccggacgatgccgcc gagaccatcctgacggtcggcgacgcggtcaagttcatcgaaaaggccgctgcctga

DBGET integrated database retrieval system