Nitrosospira sp. NRS527: NNRS527_00348 Help Entry NNRS527_00348     CDS       T08467                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism niz  Nitrosospira sp. NRS527 Pathway niz00998   Biosynthesis of various antibiotics niz01100   Metabolic pathways niz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:niz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NNRS527_00348    00074 Mycolic acid biosynthesis     NNRS527_00348   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NNRS527_00348 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 RnlA_toxin_N Motif Other DBs NCBI-ProteinID:  BCT66780 LinkDB All DBs Position complement(372562..372813) Genome browser AA seq 83 aa AA seqDB search MDTADIETKVIQFIATKAENLDASTINRSSKFEELGLDSMDTIQLLFDAEDAFGINFDSE EAKGFSSVGDIISYIEKHQATAP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggacacagcagatatcgaaacgaaggtcatacagtttattgctacaaaagctgagaat ctggatgcatccacgataaacaggtcttcgaaatttgaagagctcgggcttgactccatg gatacgattcagcttttattcgatgctgaagatgctttcggaatcaatttcgacagtgag gaagcaaagggattcagcagtgtcggagatattatttcctatatcgaaaaacaccaggct acggcgccttga

DBGET integrated database retrieval system