Nitrosospira sp. NRS527: NNRS527_01101 Help Entry NNRS527_01101     CDS       T08467                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism niz  Nitrosospira sp. NRS527 Pathway niz00998   Biosynthesis of various antibiotics niz01100   Metabolic pathways niz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:niz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NNRS527_01101    00074 Mycolic acid biosynthesis     NNRS527_01101   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NNRS527_01101 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  BCT67516 LinkDB All DBs Position 1169293..1169529 Genome browser AA seq 78 aa AA seqDB search MENVEQRIKKIVAEQLGVNEADVKSESSFVDDLGADSLDTVELVMALEEEFECEIPDEQA EKINTVQQAIDYINSHSN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaaatgtagagcagcgtataaaaaaaatagtggccgagcagttaggagtgaatgag gccgacgtcaagagtgaatcttcttttgtggatgacctgggtgccgattcgcttgacacc gtagagctggtcatggcactggaagaagaattcgaatgcgaaatccctgatgaacaggca gagaaaatcaacactgttcagcaggctatcgactacatcaattcccacagcaattaa

DBGET integrated database retrieval system