Nitrosospira sp. NRS527: NNRS527_01519 Help Entry NNRS527_01519     CDS       T08467                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism niz  Nitrosospira sp. NRS527 Pathway niz00362   Benzoate degradation niz00622   Xylene degradation niz01100   Metabolic pathways niz01120   Microbial metabolism in diverse environments niz01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:niz00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NNRS527_01519    00622 Xylene degradation     NNRS527_01519    00621 Dioxin degradation     NNRS527_01519 Enzymes [BR:niz01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      NNRS527_01519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 DUF3731 Tautomerase_2 Motif Other DBs NCBI-ProteinID:  BCT67927 LinkDB All DBs Position complement(1602189..1602377) Genome browser AA seq 62 aa AA seqDB search MPYVNIRIAGTLSREQKKQIAQEITDTLERVAHKPKSYTYIAFDELPHESWAIGGKLLGE GD NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccctacgtcaatatacgcattgccggcaccctcagccgcgagcagaagaaacagatt gctcaggaaataaccgatacgctcgagcgagtcgcgcacaagccgaaatcctatacctat attgctttcgatgaattgcctcacgaaagttgggccatcgggggcaaactgctgggtgag ggggactga

DBGET integrated database retrieval system