KEGG   Nitrosospira sp. NRS527: NNRS527_01774
Entry
NNRS527_01774     CDS       T08467                                 
Name
(GenBank) Glutamate-pyruvate aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
niz  Nitrosospira sp. NRS527
Pathway
niz00220  Arginine biosynthesis
niz00250  Alanine, aspartate and glutamate metabolism
niz00290  Valine, leucine and isoleucine biosynthesis
niz01100  Metabolic pathways
niz01110  Biosynthesis of secondary metabolites
niz01210  2-Oxocarboxylic acid metabolism
niz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:niz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NNRS527_01774
   00290 Valine, leucine and isoleucine biosynthesis
    NNRS527_01774
   00220 Arginine biosynthesis
    NNRS527_01774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:niz01007]
    NNRS527_01774
Enzymes [BR:niz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NNRS527_01774
    2.6.1.66  valine---pyruvate transaminase
     NNRS527_01774
Amino acid related enzymes [BR:niz01007]
 Aminotransferase (transaminase)
  Class I
   NNRS527_01774
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Alliinase_C Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Spherulin4
Other DBs
NCBI-ProteinID: BCT68182
LinkDB
Position
complement(1868350..1869576)
AA seq 408 aa
MQPILKSSKLANVCYDIRGPVLDRSRQMEEEGHYIIKLNIGNPASFGFDAPEEILQDVIH
NLSAASGYCDSKGLFAARKAIMHYTQEKRIQDVRMEDIYIGNGVSELIVMAMQALLNTGD
EVLIPSPDYPLWTAAVVLAGGTARHYVCDEQSGWLPDLDDIRSKVTPNTRAIVVINPNNP
TGALYPDDMLREIIEIARQHQLIIYADEIYDKVLYDGATHTSIASLADDILFVTLNGLSK
NYRAAGFRSGWAVVSGTKQFARDYISGLTMLASMRLCANVPSQFGIQTALGGYQSIKDLV
MPTGRLMRQRDLAWKLLTDIPGVTCYKPQAAMYLFPRLDPEMYPIEDDEQFALDLLLEEK
VLLVQGSGFNWPFTDHFRVVFLPNSDDLTEAIGRIANFLERYRKRCRT
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcaacccatcctgaaatccagcaaactggcgaacgtatgctatgacatccgcgggccg
gtgctcgaccgctcgagacaaatggaagaggaagggcactacatcatcaagctcaatatc
ggcaatccggcatcattcggtttcgatgcgcccgaggagattctgcaggacgtcattcat
aacctctccgccgcgtccggttactgcgactcgaaaggcttgttcgccgcgcgcaaggcg
atcatgcattacacccaggaaaaacgcatccaggacgtgcggatggaggatatttacatc
ggcaacggcgtttccgagttgatcgtgatggcgatgcaggcgctgttgaataccggcgac
gaggtcctgatcccctcccccgactatccgttgtggacagcggcggtggtgttggcgggt
ggcacggcgcggcattatgtatgcgatgagcaatccggatggttgccggacctggacgat
atacgttcgaaggttacgccgaacacccgcgccatcgttgtcattaatcccaataatcct
accggcgcgctgtatccggatgacatgctgcgtgaaattatcgagatcgcccgccagcat
cagctcatcatttatgcggatgaaatttacgataaggtactgtacgatggcgccacgcac
acttcgatagcctcgctggcagacgacattctatttgtcactttgaacggcttatccaag
aattatcgtgccgccgggtttcgctccggctgggcggtggtttcgggaacaaaacaattt
gcccgcgattatatatcgggactgaccatgcttgcttccatgcgcctgtgtgcaaacgtt
ccctcgcaattcggcattcagaccgcgcttggcggctatcagagcatcaaggacctggtg
atgccgacagggcggctcatgcggcagcgtgatctcgcctggaaattgctgaccgatatt
cccggcgttacgtgctacaagccacaggcggcgatgtatttattcccgcgcctggatccg
gaaatgtatccgatcgaggacgacgagcagtttgcgctggatctgctgctggaagagaag
gtgctactggtgcagggcagcggtttcaactggccattcaccgatcactttcgtgtggtt
tttttgcccaacagcgatgaccttaccgaagcaatcggccgcatagcgaatttccttgaa
cggtatcgcaagcgatgccgaacctga

DBGET integrated database retrieval system