Nitrospira japonica: NSJP_1771 Help Entry NSJP_1771         CDS       T05001                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism nja  Nitrospira japonica Pathway nja00998   Biosynthesis of various antibiotics nja01100   Metabolic pathways nja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NSJP_1771 (acpP)    00074 Mycolic acid biosynthesis     NSJP_1771 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NSJP_1771 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N NirdL-like_HTH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  SLM47943 UniProt:  A0A1W1I538 LinkDB All DBs Position I:1690426..1690659 Genome browser AA seq 77 aa AA seqDB search MATVDERVKKIIAEQLGVEEDEVTSEASFVEDLGADSLDTVELVMALEEEFGIEIPDEDA EKILTVGKALDYIKEKA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaacggtagacgaacgggtcaagaaaattatcgccgaacagctgggagtcgaagaa gacgaagtgacgagcgaagcgagcttcgtagaggatcttggcgccgattctctcgacacg gtcgagttggtgatggcgctggaggaagaattcggcattgagatccccgatgaagacgcg gaaaaaattctgacggtcggcaaggcattggactacatcaaggaaaaagcctaa

DBGET integrated database retrieval system