Nitrospira japonica: NSJP_3516 Help Entry NSJP_3516         CDS       T05001                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism nja  Nitrospira japonica Pathway nja00998   Biosynthesis of various antibiotics nja01100   Metabolic pathways nja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NSJP_3516 (acpP)    00074 Mycolic acid biosynthesis     NSJP_3516 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NSJP_3516 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  SLM49683 UniProt:  A0A1W1IA92 LinkDB All DBs Position I:3385477..3385776 Genome browser AA seq 99 aa AA seqDB search MTDRVVMEKIIAALAEYLRRDPLTIQENYHLRDDLGLDSMAVIELLYKIEENFNIQIPDE DLVGLTTVGSVAEYVQHRLAPAKPVASGPGKAKTKKSKG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgaccgtgtcgtaatggagaaaatcattgccgctttggctgagtatttgcggcga gaccccctgaccattcaggaaaactatcatctccgggacgatcttggactggattccatg gcggtcattgaactgctgtacaagattgaagaaaacttcaacattcagattcccgacgag gatctggtcgggttgacgacagtcggttccgttgccgagtacgtccaacatcgtctggct cccgccaaacccgtcgcctcggggccgggaaaagccaagacgaaaaagagcaaaggctga

DBGET integrated database retrieval system