Neptunomonas japonica: NEJAP_0565 Help Entry NEJAP_0565        CDS       T07060                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism njp  Neptunomonas japonica Brite KEGG Orthology (KO) [BR:njp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:njp03036]     NEJAP_0565 (zapB) Chromosome and associated proteins [BR:njp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     NEJAP_0565 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YwqH-like CENP-F_leu_zip DUF6058 Tup_N Nuf2_DHR10-like YabA Spc7 JIP_LZII TSC22 DUF16 CCDC138_cc HALZ DUF2205 DUF4140 DUF5595 bZIP_1 Motif Other DBs NCBI-ProteinID:  BBB28522 UniProt:  A0A7R6PEB1 LinkDB All DBs Position complement(631265..631453) Genome browser AA seq 62 aa AA seqDB search MQTELFNQLETKIESMIDEVELLRMEISELREAKQKLEDGQQVWQENLQQLLNKFDSVDA AE NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccgagctgttcaaccagttagaaactaaaattgaaagcatgatcgacgaagtc gagttactaagaatggaaataagcgaactacgtgaagcaaaacaaaaattggaagacgga caacaagtctggcaggaaaacctgcagcaactcctgaataaatttgattcagtagacgcc gcagaatag

DBGET integrated database retrieval system