Neptunomonas japonica: NEJAP_3053 Help Entry NEJAP_3053        CDS       T07060                                  Symbol hfq Name (GenBank) host factor-I protein   KO K03666   host factor-I protein Organism njp  Neptunomonas japonica Pathway njp02024   Quorum sensing njp03018   RNA degradation Brite KEGG Orthology (KO) [BR:njp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NEJAP_3053 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NEJAP_3053 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:njp03019]     NEJAP_3053 (hfq)    03036 Chromosome and associated proteins [BR:njp03036]     NEJAP_3053 (hfq) Messenger RNA biogenesis [BR:njp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NEJAP_3053 (hfq) Chromosome and associated proteins [BR:njp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NEJAP_3053 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BBB30992 UniProt:  A0A7R6SXT6 LinkDB All DBs Position complement(3357814..3358053) Genome browser AA seq 79 aa AA seqDB search MSKGQSLQDPYLNVLRKERVPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVKLPQPDEVQPD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcagtctctacaagacccttatctgaacgttctacgcaaggaacgtgtt cccgtttcaattttcttggtaaacggtattaagctgcaggggcagattgaatctttcgat caatttgttattttgcttaaaaatacggtaagccagatggtgtataaacacgccatttct acggttgtcccatcacgcccggtgaaattgccacagcctgatgaagtacaacccgactga

DBGET integrated database retrieval system