Candidatus Nitrospira kreftii: Nkreftii_000199 Help Entry Nkreftii_000199   CDS       T08052                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism nkf  Candidatus Nitrospira kreftii Pathway nkf00998   Biosynthesis of various antibiotics nkf01100   Metabolic pathways nkf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nkf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Nkreftii_000199    00074 Mycolic acid biosynthesis     Nkreftii_000199   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Nkreftii_000199 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding EAD10 Motif Other DBs NCBI-ProteinID:  QPD02425 UniProt:  A0A7S8FAV8 LinkDB All DBs Position complement(188140..188412) Genome browser AA seq 90 aa AA seqDB search MNTPDEISQTILRLLSEIAPEADVTVLNPDVSFRDQLDIDSMDFLNFVIMIHKTFGVEIP ETDYPKYGTLNGCVEQLSGKRASGSPSPVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacacgccggatgaaatcagccagacgatccttcgcctccttagcgagatcgcgccg gaagcagacgtcacagtcttgaaccctgacgtcagcttccgtgatcagttggatattgac tcgatggacttcctcaatttcgtgatcatgatccacaaaaccttcggtgtagagatcccg gaaaccgactatccgaagtacggcacgctcaatggttgtgtggagcagttgtcaggcaag cgagcaagtggctctccctctcccgtcaattag

DBGET integrated database retrieval system