Nitratireductor kimnyeongensis: KW403_03590
Help
Entry
KW403_03590 CDS
T07526
Name
(GenBank) MotB family protein
KO
K02557
chemotaxis protein MotB
Organism
nki
Nitratireductor kimnyeongensis
Pathway
nki02030
Bacterial chemotaxis
nki02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
nki00001
]
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
KW403_03590
02040 Flagellar assembly
KW403_03590
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
nki02000
]
KW403_03590
02035 Bacterial motility proteins [BR:
nki02035
]
KW403_03590
Transporters [BR:
nki02000
]
Other transporters
Pores ion channels [TC:
1
]
KW403_03590
Bacterial motility proteins [BR:
nki02035
]
Flagellar system
Flagellar assembly proteins
Stator
KW403_03590
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MotB_plug
OmpA
Motif
Other DBs
NCBI-ProteinID:
QZZ36241
LinkDB
All DBs
Position
760275..761615
Genome browser
AA seq
446 aa
AA seq
DB search
MSVAEDEDRASEIIIVRRGGGDEDEGHHGGAWKIAFADFMTAMMCFFLVMWLINATDEDT
KTALASYFNPVQLIDRNTSSKGLEDVDGDPVDSAPNDVEDDAPGAPSENKDQTSGPMSFE
NSVGQSDIQKLSDENLFSDPYAVLAEIASNTDTMQNISQKGDGGAQIAGPSSGASGGESY
RDPFAPDFWSQQVARPQIGVQGDPDNARENPAGTDADLPSNGTNPPPAAAREIAEAEAGT
EIALEPVREVQPLKPLEREDVATQATTPPETSQSSESDAAEASAEPPAQDALERGEQLAE
KIRSQLAAQFAGTPLESSISVVATDEGVLVSITDDLENGMFPVGSAVPQRELVLAMDKIG
QTLSEQSGRVSVRGHTDGRPFRSETYDNWRLSSARAQAAYYMLVRGGLDELRIQQVAGFA
DRKLKVPEDPYASANRRIEILLEVPR
NT seq
1341 nt
NT seq
+upstream
nt +downstream
nt
atgagcgttgcggaagacgaggatcgcgcctcggagatcattatcgttcgtcgcggcggc
ggcgacgaagacgagggccatcatggtggggcatggaagatcgcttttgcggatttcatg
accgccatgatgtgctttttcctggtgatgtggcttatcaacgcgaccgacgaagatacc
aaaaccgcgcttgcaagttacttcaaccccgtgcagctcattgatcgcaacacgagcagc
aagggtcttgaggacgtcgacggtgatccggtcgacagcgcgcccaacgatgtagaggat
gatgcaccaggtgcaccatcggagaacaaggatcagacatccggcccgatgagttttgaa
aattcggttggccagtcggacatccagaaactgtctgacgagaacctgttctctgatccg
tatgccgtgcttgccgaaatcgcatccaacaccgacacgatgcagaacatttctcaaaaa
ggggatggaggcgcacagattgcgggcccctcctccggcgcatccggaggagaatcctac
cgcgatccattcgcacccgatttctggtcgcagcaggtcgcgcgaccgcagataggtgtt
cagggggatcccgacaatgcacgtgaaaaccctgctggaaccgatgccgatctcccgagc
aatggcaccaatccgccaccagccgcggctcgggaaatagccgaggcagaggccggaacc
gaaatcgctctggagccggttcgcgaggtccagcccctcaaacctctggagcgggaagac
gttgccacacaggcaaccactcctcctgaaacatcacagagtagcgagagcgatgccgcg
gaagcgtccgccgagcctcctgcacaagatgcgttggaaagaggtgagcagctggccgaa
aagatccgatcccagcttgctgcacaatttgccggaacaccgcttgagagctccatatcc
gtcgtagcaaccgacgagggcgtgcttgtttcgatcaccgacgatcttgaaaacggcatg
ttcccggtagggtccgcggtaccgcagcgcgagctcgttctcgccatggacaagatcggt
cagaccttgagcgagcagtcgggcagggtgagtgtgcgcggccacacggacgggcgcccc
ttccgcagcgagacttacgacaactggcgtctgtccagcgcgcgcgctcaggcggcttac
tacatgctcgtgcggggtgggctggatgagttgcgcattcagcaagtggcaggcttcgcc
gaccgcaagctgaaggtgccggaagatccctacgccagcgccaaccgtcgcatcgaaatc
cttctggaagtgccgcgatga
DBGET
integrated database retrieval system