Nitratireductor kimnyeongensis: KW403_15260 Help Entry KW403_15260       CDS       T07526                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nki  Nitratireductor kimnyeongensis Pathway nki01100   Metabolic pathways nki01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nki00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KW403_15260    00074 Mycolic acid biosynthesis     KW403_15260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KW403_15260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QZZ35114 LinkDB All DBs Position 3214596..3214832 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVEGDKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKATT NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgcagaacgcgttaagaaaatcgttgtcgaacatctgggcgtcgaaggc gacaaggtgaccgaaggcgcaagcttcattgatgatcttggtgcagacagcctcgacacg gtcgagctggtcatggcctttgaagaagagttcggcgttgaaattccggatgacgctgcc gagacgattctcaccgttggcgacgcggtgaaatacatcgacaaggcgaccacctga

DBGET integrated database retrieval system