Candidatus Nitrosopumilus koreensis: NKOR_02760 Help Entry NKOR_02760        CDS       T02304                                  Name (GenBank) 30S ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nkr  Candidatus Nitrosopumilus koreensis Pathway nkr03010   Ribosome Brite KEGG Orthology (KO) [BR:nkr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NKOR_02760   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NKOR_02760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nkr03011]     NKOR_02760    04121 Ubiquitin system [BR:nkr04121]     NKOR_02760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nkr04147]     NKOR_02760 Ribosome [BR:nkr03011]  Ribosomal proteins   Eukaryotes    Small subunit     NKOR_02760   Archaea     NKOR_02760 Ubiquitin system [BR:nkr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NKOR_02760 Exosome [BR:nkr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NKOR_02760   Exosomal proteins of colorectal cancer cells    NKOR_02760 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e DUF1451 Cas12f1-like_TNB Zn_ribbon_RPAB4 DZR_2 Zn_ribbon_Nudix Phage_GP58 Alsin_RLD DUF8096 PknG_rubred Motif Other DBs NCBI-ProteinID:  AFS80446 UniProt:  K0B7L7 LinkDB All DBs Position complement(475825..475998) Genome browser AA seq 57 aa AA seqDB search MAGKKGSSPNVYAYYKVDGDKVSRIKKICSRCGKGVFMSEHKDRHTCGKCGLTEFNQ NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggcaggaaagaaaggttcaagcccaaatgtctatgcatactacaaagtagacggagac aaagtatcacgaatcaagaaaatttgttcaagatgtggtaaaggtgtttttatgtcagaa cacaaagatagacacacatgtggaaaatgtggattaacagaatttaatcaataa

DBGET integrated database retrieval system