Neisseria lactamica: NLA_4620 Help Entry NLA_4620          CDS       T01368                                  Name (GenBank) putative periplasmic protein   KO K03586   cell division protein FtsL Organism nla  Neisseria lactamica Brite KEGG Orthology (KO) [BR:nla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nla03036]     NLA_4620 Chromosome and associated proteins [BR:nla03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     NLA_4620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Arm-DNA-bind_3 Motif Other DBs NCBI-ProteinID:  CBN86702 UniProt:  E4ZBH5 LinkDB All DBs Position 440161..440424 Genome browser AA seq 87 aa AA seqDB search MNKLNFFLLPAVCVSAFLVVIQQNQYRLNFTALDKAKKQEIALEQDYAQMRLQQARLANH EAIRAAAEKQNLRPPASGNTFMVEHQR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaataaattgaatttctttctgctgccggcggtttgtgtttcggcttttctcgtcgtg attcagcaaaaccagtacaggcttaactttacggctttggataaggcaaaaaaacaggaa atcgccttggagcaggattacgcgcaaatgaggctgcaacaggcgcgtttggcgaaccac gaagcgattagggcggcggcagaaaaacaaaacctccgcccgccggcttcaggcaatacc tttatggtggaacatcaaagatag

DBGET integrated database retrieval system