KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586234
Entry
100586234         CDS       T03265                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04114  Oocyte meiosis
nle04218  Cellular senescence
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04371  Apelin signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04728  Dopaminergic synapse
nle04740  Olfactory transduction
nle04744  Phototransduction
nle04750  Inflammatory mediator regulation of TRP channels
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04921  Oxytocin signaling pathway
nle04922  Glucagon signaling pathway
nle04924  Renin secretion
nle04925  Aldosterone synthesis and secretion
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05031  Amphetamine addiction
nle05034  Alcoholism
nle05133  Pertussis
nle05152  Tuberculosis
nle05163  Human cytomegalovirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05214  Glioma
nle05417  Lipid and atherosclerosis
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100586234
   04015 Rap1 signaling pathway
    100586234
   04371 Apelin signaling pathway
    100586234
   04020 Calcium signaling pathway
    100586234
   04070 Phosphatidylinositol signaling system
    100586234
   04024 cAMP signaling pathway
    100586234
   04022 cGMP-PKG signaling pathway
    100586234
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100586234
   04218 Cellular senescence
    100586234
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100586234
  09152 Endocrine system
   04910 Insulin signaling pathway
    100586234
   04922 Glucagon signaling pathway
    100586234
   04912 GnRH signaling pathway
    100586234
   04915 Estrogen signaling pathway
    100586234
   04921 Oxytocin signaling pathway
    100586234
   04916 Melanogenesis
    100586234
   04924 Renin secretion
    100586234
   04925 Aldosterone synthesis and secretion
    100586234
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100586234
   04270 Vascular smooth muscle contraction
    100586234
  09154 Digestive system
   04970 Salivary secretion
    100586234
   04971 Gastric acid secretion
    100586234
  09156 Nervous system
   04728 Dopaminergic synapse
    100586234
   04720 Long-term potentiation
    100586234
   04722 Neurotrophin signaling pathway
    100586234
  09157 Sensory system
   04744 Phototransduction
    100586234
   04740 Olfactory transduction
    100586234
   04750 Inflammatory mediator regulation of TRP channels
    100586234
  09159 Environmental adaptation
   04713 Circadian entrainment
    100586234
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100586234
  09162 Cancer: specific types
   05214 Glioma
    100586234
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100586234
   05163 Human cytomegalovirus infection
    100586234
   05167 Kaposi sarcoma-associated herpesvirus infection
    100586234
  09171 Infectious disease: bacterial
   05133 Pertussis
    100586234
   05152 Tuberculosis
    100586234
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100586234
   05012 Parkinson disease
    100586234
   05022 Pathways of neurodegeneration - multiple diseases
    100586234
  09165 Substance dependence
   05031 Amphetamine addiction
    100586234
   05034 Alcoholism
    100586234
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100586234
   05418 Fluid shear stress and atherosclerosis
    100586234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100586234
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100586234
   03036 Chromosome and associated proteins [BR:nle03036]
    100586234
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100586234
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100586234
Membrane trafficking [BR:nle04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100586234
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100586234
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100586234
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 CFAP251_C EF-hand_FSTL1 AIF-1 EF_EFCAB10_C EF-hand_EFHB_C EFhand_Ca_insen PmbA_TldD_1st DUF4824 RloB
Other DBs
NCBI-GeneID: 100586234
NCBI-ProteinID: XP_030668324
LinkDB
Position
5:complement(124580758..124581309)
AA seq 116 aa
MRSLRQHPTEAELQDMTYEVDADSNGRVGFPESVTMRARKMKDAGSEEEMREAFRVFDKD
GNGYTSAPELRHAMRNLGEKLTDEEVDEMIREADIDGDSQVNYEEFAQAGHGGSRL
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaggtctcttaggcagcatcccacagaagcggagttacaggacatgacttacgaagta
gatgctgatagtaatggcagagttggcttccctgaatctgtgacaatgagagcaagaaaa
atgaaagatgcaggcagtgaagaagaaatgagagaagcattccgtgtgtttgataaggat
ggcaatggttatactagtgccccagaacttcgccatgcgatgagaaaccttggagagaag
ttaacagatgaagaggttgatgaaatgatcagggaagcagatattgatggtgacagtcaa
gtaaactatgaggagtttgcacaggctgggcatggtggctcacgcctgtaa

DBGET integrated database retrieval system