Entry |
|
Symbol |
RAC2
|
Name |
(RefSeq) ras-related C3 botulinum toxin substrate 2
|
KO |
K07860 | Ras-related C3 botulinum toxin substrate 2 |
|
Organism |
nle Nomascus leucogenys (northern white-cheeked gibbon)
|
Pathway |
nle04613 | Neutrophil extracellular trap formation |
nle04650 | Natural killer cell mediated cytotoxicity |
nle04662 | B cell receptor signaling pathway |
nle04664 | Fc epsilon RI signaling pathway |
nle04666 | Fc gamma R-mediated phagocytosis |
nle04670 | Leukocyte transendothelial migration |
nle04810 | Regulation of actin cytoskeleton |
nle05163 | Human cytomegalovirus infection |
nle05170 | Human immunodeficiency virus 1 infection |
nle05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:nle00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100598232 (RAC2)
04014 Ras signaling pathway
100598232 (RAC2)
04015 Rap1 signaling pathway
100598232 (RAC2)
04310 Wnt signaling pathway
100598232 (RAC2)
04370 VEGF signaling pathway
100598232 (RAC2)
04071 Sphingolipid signaling pathway
100598232 (RAC2)
04024 cAMP signaling pathway
100598232 (RAC2)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
100598232 (RAC2)
04520 Adherens junction
100598232 (RAC2)
09142 Cell motility
04810 Regulation of actin cytoskeleton
100598232 (RAC2)
09150 Organismal Systems
09151 Immune system
04613 Neutrophil extracellular trap formation
100598232 (RAC2)
04650 Natural killer cell mediated cytotoxicity
100598232 (RAC2)
04662 B cell receptor signaling pathway
100598232 (RAC2)
04664 Fc epsilon RI signaling pathway
100598232 (RAC2)
04666 Fc gamma R-mediated phagocytosis
100598232 (RAC2)
04670 Leukocyte transendothelial migration
100598232 (RAC2)
04062 Chemokine signaling pathway
100598232 (RAC2)
09158 Development and regeneration
04360 Axon guidance
100598232 (RAC2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100598232 (RAC2)
05231 Choline metabolism in cancer
100598232 (RAC2)
09162 Cancer: specific types
05210 Colorectal cancer
100598232 (RAC2)
05212 Pancreatic cancer
100598232 (RAC2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
100598232 (RAC2)
05163 Human cytomegalovirus infection
100598232 (RAC2)
09171 Infectious disease: bacterial
05135 Yersinia infection
100598232 (RAC2)
09164 Neurodegenerative disease
05020 Prion disease
100598232 (RAC2)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
100598232 (RAC2)
05415 Diabetic cardiomyopathy
100598232 (RAC2)
05416 Viral myocarditis
100598232 (RAC2)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:nle04031]
100598232 (RAC2)
GTP-binding proteins [BR:nle04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
100598232 (RAC2)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
7b:13110395..13129174
|
AA seq |
192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRSCSLL |
NT seq |
579 nt +upstreamnt +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctataccaccaacgcctttcctggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctacccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaatgtccgcgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgctcctgcagcctcctctag |