KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600574
Entry
100600574         CDS       T03265                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04114  Oocyte meiosis
nle04140  Autophagy - animal
nle04148  Efferocytosis
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04218  Cellular senescence
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04350  TGF-beta signaling pathway
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04517  IgSF CAM signaling
nle04520  Adherens junction
nle04540  Gap junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04621  NOD-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04657  IL-17 signaling pathway
nle04658  Th1 and Th2 cell differentiation
nle04659  Th17 cell differentiation
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle05010  Alzheimer disease
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05034  Alcoholism
nle05132  Salmonella infection
nle05133  Pertussis
nle05135  Yersinia infection
nle05140  Leishmaniasis
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05207  Chemical carcinogenesis - receptor activation
nle05208  Chemical carcinogenesis - reactive oxygen species
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100600574 (MAPK1)
   04012 ErbB signaling pathway
    100600574 (MAPK1)
   04014 Ras signaling pathway
    100600574 (MAPK1)
   04015 Rap1 signaling pathway
    100600574 (MAPK1)
   04350 TGF-beta signaling pathway
    100600574 (MAPK1)
   04370 VEGF signaling pathway
    100600574 (MAPK1)
   04371 Apelin signaling pathway
    100600574 (MAPK1)
   04668 TNF signaling pathway
    100600574 (MAPK1)
   04066 HIF-1 signaling pathway
    100600574 (MAPK1)
   04068 FoxO signaling pathway
    100600574 (MAPK1)
   04072 Phospholipase D signaling pathway
    100600574 (MAPK1)
   04071 Sphingolipid signaling pathway
    100600574 (MAPK1)
   04024 cAMP signaling pathway
    100600574 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100600574 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100600574 (MAPK1)
   04150 mTOR signaling pathway
    100600574 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100600574 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100600574 (MAPK1)
   04148 Efferocytosis
    100600574 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100600574 (MAPK1)
   04210 Apoptosis
    100600574 (MAPK1)
   04218 Cellular senescence
    100600574 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100600574 (MAPK1)
   04520 Adherens junction
    100600574 (MAPK1)
   04540 Gap junction
    100600574 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100600574 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100600574 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100600574 (MAPK1)
   04613 Neutrophil extracellular trap formation
    100600574 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100600574 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100600574 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100600574 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100600574 (MAPK1)
   04660 T cell receptor signaling pathway
    100600574 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100600574 (MAPK1)
   04659 Th17 cell differentiation
    100600574 (MAPK1)
   04657 IL-17 signaling pathway
    100600574 (MAPK1)
   04662 B cell receptor signaling pathway
    100600574 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100600574 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100600574 (MAPK1)
   04062 Chemokine signaling pathway
    100600574 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100600574 (MAPK1)
   04929 GnRH secretion
    100600574 (MAPK1)
   04912 GnRH signaling pathway
    100600574 (MAPK1)
   04915 Estrogen signaling pathway
    100600574 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100600574 (MAPK1)
   04917 Prolactin signaling pathway
    100600574 (MAPK1)
   04921 Oxytocin signaling pathway
    100600574 (MAPK1)
   04926 Relaxin signaling pathway
    100600574 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100600574 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100600574 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100600574 (MAPK1)
   04916 Melanogenesis
    100600574 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100600574 (MAPK1)
   04270 Vascular smooth muscle contraction
    100600574 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100600574 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100600574 (MAPK1)
   04725 Cholinergic synapse
    100600574 (MAPK1)
   04726 Serotonergic synapse
    100600574 (MAPK1)
   04720 Long-term potentiation
    100600574 (MAPK1)
   04730 Long-term depression
    100600574 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100600574 (MAPK1)
   04722 Neurotrophin signaling pathway
    100600574 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100600574 (MAPK1)
   04380 Osteoclast differentiation
    100600574 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100600574 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100600574 (MAPK1)
   05206 MicroRNAs in cancer
    100600574 (MAPK1)
   05205 Proteoglycans in cancer
    100600574 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    100600574 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100600574 (MAPK1)
   05203 Viral carcinogenesis
    100600574 (MAPK1)
   05230 Central carbon metabolism in cancer
    100600574 (MAPK1)
   05231 Choline metabolism in cancer
    100600574 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100600574 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100600574 (MAPK1)
   05212 Pancreatic cancer
    100600574 (MAPK1)
   05225 Hepatocellular carcinoma
    100600574 (MAPK1)
   05226 Gastric cancer
    100600574 (MAPK1)
   05214 Glioma
    100600574 (MAPK1)
   05216 Thyroid cancer
    100600574 (MAPK1)
   05221 Acute myeloid leukemia
    100600574 (MAPK1)
   05220 Chronic myeloid leukemia
    100600574 (MAPK1)
   05218 Melanoma
    100600574 (MAPK1)
   05211 Renal cell carcinoma
    100600574 (MAPK1)
   05219 Bladder cancer
    100600574 (MAPK1)
   05215 Prostate cancer
    100600574 (MAPK1)
   05213 Endometrial cancer
    100600574 (MAPK1)
   05224 Breast cancer
    100600574 (MAPK1)
   05223 Non-small cell lung cancer
    100600574 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100600574 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100600574 (MAPK1)
   05161 Hepatitis B
    100600574 (MAPK1)
   05160 Hepatitis C
    100600574 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100600574 (MAPK1)
   05164 Influenza A
    100600574 (MAPK1)
   05163 Human cytomegalovirus infection
    100600574 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100600574 (MAPK1)
   05165 Human papillomavirus infection
    100600574 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100600574 (MAPK1)
   05135 Yersinia infection
    100600574 (MAPK1)
   05133 Pertussis
    100600574 (MAPK1)
   05152 Tuberculosis
    100600574 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100600574 (MAPK1)
   05140 Leishmaniasis
    100600574 (MAPK1)
   05142 Chagas disease
    100600574 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100600574 (MAPK1)
   05020 Prion disease
    100600574 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100600574 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100600574 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100600574 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100600574 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100600574 (MAPK1)
   04934 Cushing syndrome
    100600574 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100600574 (MAPK1)
   01524 Platinum drug resistance
    100600574 (MAPK1)
   01522 Endocrine resistance
    100600574 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100600574 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100600574 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100600574 (MAPK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100600574 (MAPK1)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100600574 (MAPK1)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100600574 (MAPK1)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100600574 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100600574
NCBI-ProteinID: XP_012363626
Ensembl: ENSNLEG00000000240
LinkDB
Position
7b:47703201..47814994
AA seq 361 aa
MAAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPF
EHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQ
HLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNH
ILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPH
KRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYR
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttc
gacgtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtg
tgctctgcgtatgataatgtcaacaaagttcgagtagccatcaagaaaatcagccccttt
gagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcaga
catgagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaa
gatgtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaa
cacctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatat
atccattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacacc
acctgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgat
cacacagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatg
ttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggca
gaaatgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccac
attctgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaa
gctaggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttc
ccaaatgctgactccaaagctctggacttactggacaaaatgttgacattcaacccacac
aagaggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccg
agtgacgagcccatcgccgaagcaccattcaagtttgacatggaattggatgacttgcct
aaggaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacaga
tcttaa

DBGET integrated database retrieval system