KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601566
Entry
100601566         CDS       T03265                                 
Symbol
RAB6C
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related protein Rab-6C
  KO
K07895  Ras-related protein Rab-6C
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100601566 (RAB6C)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:nle04031]
    100601566 (RAB6C)
Membrane trafficking [BR:nle04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100601566 (RAB6C)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    100601566 (RAB6C)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 100601566
NCBI-ProteinID: XP_030656778
LinkDB
Position
20:complement(33540971..33541748)
AA seq 218 aa
MYDSFDDTYQATIGIDFLSKTMYLEDGTIRLRLWDTAGQERLRSLIPSYXRDSAAAVVVY
DITNVNSFQQTTKWIDDVSTERGSDVIITLVGNKTELADKRQVSIEEGERKAKELNVMFI
ETSAKXGYNVKRLFRRVAAALPGMESTQDRSREDMRDVKLETPQEQPVSEGGCFCYSPMS
PSALPQKPPYSFTDCSVNIGLNLFPSVITFCNSSLLPV
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtatgacagttttgacgacacctatcaggcaacaattggcattgactttttatcgaaa
actatgtacttggaggatggaacaatcaggcttcggctgtgggatactgcgggtcaggaa
cgtctccgtagcctcattcccagttacnatcgtgattctgctgcagctgtagtagtttac
gatatcacaaatgttaactccttccagcaaactacaaagtggattgatgatgtcagcaca
gaaagaggaagtgatgtgatcatcacgctagtaggaaataaaacagagcttgctgacaag
aggcaagtgtcaattgaggagggagagaggaaagccaaagagctgaatgttatgtttatt
gaaacgagtgcaaaanctggatacaatgtaaagcggctctttcgacgtgtagcagcagct
ttgccgggaatggaaagcacacaggacagaagcagagaagacatgagggatgtaaaactg
gaaacgcctcaggagcaaccagtcagcgaaggaggctgtttctgctactctcccatgtca
ccttcagcccttcctcagaagcccccttactctttcactgactgcagtgtgaatattggc
ttgaaccttttcccttcagtaataacgttttgcaattcatcattgctgcctgtctag

DBGET integrated database retrieval system