Neisseria lisongii: PJU73_04500 Help Entry PJU73_04500       CDS       T09339                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism nls  Neisseria lisongii Pathway nls02024   Quorum sensing nls03018   RNA degradation Brite KEGG Orthology (KO) [BR:nls00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PJU73_04500 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PJU73_04500 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:nls03019]     PJU73_04500 (hfq)    03036 Chromosome and associated proteins [BR:nls03036]     PJU73_04500 (hfq) Messenger RNA biogenesis [BR:nls03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PJU73_04500 (hfq) Chromosome and associated proteins [BR:nls03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PJU73_04500 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WCL72363 UniProt:  A0AAW5AIV9 LinkDB All DBs Position 1008265..1008552 Genome browser AA seq 95 aa AA seqDB search MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHA ISTIVPARAVSLQHENKAPAASNLVQVETVQAAAE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacagctaaaggacaaatgttacaagatccttttttgaacgccctgcgtaaagagcat gtgccggtttccatctatctggtaaacggcatcaaactgcaaggccaagtcgaatctttc gaccaatacgttgtattgctgcgcaacacctcggtaacgcaaatggtttacaaacacgcc atttccaccatcgttcccgcccgtgccgtaagcctgcaacacgaaaacaaagccccggcc gcatccaatctggtgcaggtagaaaccgttcaggcagctgcagaataa

DBGET integrated database retrieval system