KEGG   Nilaparvata lugens (brown planthopper): 111052017
Entry
111052017         CDS       T07276                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
nlu  Nilaparvata lugens (brown planthopper)
Pathway
nlu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:nlu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111052017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nlu00199]
    111052017
Enzymes [BR:nlu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111052017
Cytochrome P450 [BR:nlu00199]
 Cytochrome P450, animal type
  CYP306 family
   111052017
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111052017
NCBI-ProteinID: XP_039293148
LinkDB
Position
10:complement(31608824..31623448)
AA seq 499 aa
MDDYSLLTISLSLLLSWLLYFLTVKILRWRVLPPGPWGLPVVGYLPWLDPEHPYLSFTNL
ARNFGPIYSIQMGRLSTIVITDPKLIKQAFNMDALTGRADLYLTHGIMKGYGLICSEGPR
WREQRKFAATCLKNQGMAKSHPKREKMEALIVSGVNDTMMRITNDESSATSGVEFSHFLI
HSIGNVMNVIIFGREYSYDDPTWKLLTHLAEEGVKLIGVAGPLNFLPFLRVIPKFRGSMD
FIVNGLERTHEIYREITAEHTGEEDDVVGSFLREQRSRDDAKVAHSFSDDQLNFLAADLF
GAGLDTTLATLRWFFTMMAVYPDKQEKVYTELSTVLGQSTKPCLEDSHRLPYLEAAVSES
QRLRTVVPTGIPHGVNTDCQLGAYRLAKGTMVVPLLWAVHMDPQIWPQPDEYRPERFLDE
DGNYRKLDALMPFQIGKRVCLGEELARMIIFLYASTILQKFKIVLPDDAIPEGKDPLEGL
CGITFLPKYGRLIFKSRVN
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatgactacagcctattgacaatctccttatcgcttctgttatcctggctgctttac
tttctcacagtcaagatcctacgatggagagtccttcccccaggaccttggggtcttccc
gtggtgggctacctgccctggcttgatcctgaacatccttacctgtccttcactaatctg
gccaggaactttggtccgatctacagcatccagatggggcggctgtccacgattgttatc
actgatcctaaactgatcaagcaggctttcaatatggatgctctgactgggagagccgat
ctatatttgacgcatggtattatgaagggatatggtttgatttgctctgaaggtccaaga
tggagggaacagagaaaatttgcagctacttgtctgaagaatcaagggatggccaaatcg
caccctaaacgagagaaaatggaagcattgattgtgagtggagtgaatgacacaatgatg
agaatcacgaatgatgaatcgtcagcgacatctggtgtggagttttcgcactttctaatt
cacagcatcggcaatgtcatgaatgtgataatttttgggcgcgaatattcctatgacgac
ccaacgtggaaactgctgacgcatttggctgaagagggagtcaagttgattggggttgct
ggtccactcaactttctaccatttttgagagtgatccccaagttcagaggctcgatggac
ttcatagtgaacgggctggagaggactcacgagatctaccgcgagataacggcggaacac
acgggcgaagaggatgacgtggtaggcagtttcctgcgggagcagaggtcacgtgacgac
gccaaggtcgctcactcgttcagcgacgaccagctcaacttcctcgcagccgatctgttt
ggtgctggcctggacaccaccctggcaaccctaagatggttcttcaccatgatggctgtt
tatcctgacaaacaggagaaagtttatacggagctgtcaacagtgctaggccagagtacc
aaaccttgcctggaagacagtcaccgcctgccctacctggaggcggcagtcagcgaaagt
cagcgactgaggacagtggtgccaaccggcatccctcacggggtcaacactgactgtcag
ctgggtgcctacaggctggcaaagggcacaatggtggtacccctgttgtgggccgtgcac
atggatccccaaatttggccccagcctgacgaatatcgtcccgagaggttcttggatgag
gacggcaactacaggaagctggatgcgttgatgcctttccagattggtaaacgtgtttgt
cttggcgaggagctggcaagaatgatcattttcctgtacgctagcaccattttgcaaaaa
tttaaaatagtattgccagatgatgcaatacctgaagggaaagatcctttggagggattg
tgtgggattacgtttttaccgaaatatggacgactgattttcaaatcaagagtcaattga

DBGET integrated database retrieval system