Nilaparvata lugens (brown planthopper): 111053497 Help Entry 111053497         CDS       T07276                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nlu  Nilaparvata lugens (brown planthopper) Pathway nlu04013   MAPK signaling pathway - fly nlu04145   Phagosome nlu04148   Efferocytosis nlu04310   Wnt signaling pathway nlu04517   IgSF CAM signaling nlu04518   Integrin signaling nlu04620   Toll-like receptor signaling pathway nlu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nlu00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111053497    04310 Wnt signaling pathway     111053497   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     111053497    04518 Integrin signaling     111053497  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111053497    04148 Efferocytosis     111053497  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111053497  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111053497  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nlu04131]     111053497   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nlu04147]     111053497    04031 GTP-binding proteins [BR:nlu04031]     111053497 Membrane trafficking [BR:nlu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111053497  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111053497   Macropinocytosis    Ras GTPases     111053497  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111053497 Exosome [BR:nlu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111053497   Exosomal proteins of other body fluids (saliva and urine)    111053497   Exosomal proteins of colorectal cancer cells    111053497   Exosomal proteins of bladder cancer cells    111053497 GTP-binding proteins [BR:nlu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111053497 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Tnp_22_dsRBD Motif Other DBs NCBI-GeneID:  111053497 NCBI-ProteinID:  XP_022196088 LinkDB All DBs Position 8:44968411..44989246 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPTTPIILVGTKLDLR EDKETIEKLKEKKLQPITYPMGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LHVPHRRKCVIV NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccataaagtgtgtggttgttggtgatggtgccgttggtaaaacatgtcttctt atcagctacacaactaatgcctttccgggagaatatatacctacagtattcgacaattat tcagcaaatgtgatggttgatggcaagccgatcaatctgggactatgggatacagctggt caggaagattacgacaggttacgaccactgtcttacccacaaacggatgtatttttaata tgcttctcacttgtaaatcctgcttcattcgaaaacgtcagagctaagtggtaccctgaa gttagacatcactgccctaccacacccataattcttgtcggaacaaagctggatctgcgc gaggacaaagaaacaatcgaaaaactgaaagaaaagaagcttcagccaatcacctatccc atgggcttgtcaatggcgaaagaaatcggagccgtgaagtacctagaatgcagcgccctc acccagaagggcctcaagacagttttcgacgaggcgattcgcgccgtgctctgtcccgtg ctgcatgtaccgcaccgacggaaatgcgtcatcgtctag

DBGET integrated database retrieval system