Nilaparvata lugens (brown planthopper): 120349123 Help Entry 120349123         CDS       T07276                                  Name (RefSeq) histone deacetylase 4-like   KO K11407   histone deacetylase 6 [EC:3.5.1.98] Organism nlu  Nilaparvata lugens (brown planthopper) Brite KEGG Orthology (KO) [BR:nlu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nlu01009]     120349123   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:nlu03019]     120349123    04131 Membrane trafficking [BR:nlu04131]     120349123    03036 Chromosome and associated proteins [BR:nlu03036]     120349123 Enzymes [BR:nlu01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.1  In linear amides     3.5.1.98  histone deacetylase      120349123 Protein phosphatases and associated proteins [BR:nlu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      120349123 Messenger RNA biogenesis [BR:nlu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     Stress granule specific factors      120349123 Membrane trafficking [BR:nlu04131]  Autophagy   Aggrephagy    Other aggrephagy associated proteins     120349123 Chromosome and associated proteins [BR:nlu03036]  Eukaryotic type   Histone modification proteins    HDACs (histone deacetylases)     Class II HDACs      120349123 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hist_deacetyl Motif Other DBs NCBI-GeneID:  120349123 NCBI-ProteinID:  XP_039275018 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search TNPLNRQKLDMNKLSQLPIKSFVRLACGGVGVDSDTTWNELHTAPAARMAVGCVVELAMK TAMGDMKNGMAVVRPPGHHAETSRRWALFLQLCGHSCQVLLQKDLMRRILIVDW NT seq 344 nt NT seq  +upstreamnt  +downstreamnt gtaccaacccgctgaatagacagaagttggacatgaacaaactgtcccaattgccgatca agagttttgtgcggctggcttgcgggggtgtcggtgttgattcggataccacctggaatg aactccataccgcacctgcggccaggatggctgtcgggtgtgtcgtcgaactggccatga aaactgcaatgggagacatgaagaatggcatggcggtagtaagacctccaggtcaccacg cggagacctcacggcgatgggctttgtttcttcaactctgtggccatagctgccaggtgc tgctgcaaaaagacttgatgaggcggatacttatagttgattgg

DBGET integrated database retrieval system