Nomia melanderi (Alkali bee): 116429337 Help Entry 116429337         CDS       T07404                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nmea  Nomia melanderi (Alkali bee) Pathway nmea04013   MAPK signaling pathway - fly nmea04145   Phagosome nmea04148   Efferocytosis nmea04310   Wnt signaling pathway nmea04620   Toll-like receptor signaling pathway nmea05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nmea00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     116429337    04310 Wnt signaling pathway     116429337  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     116429337    04148 Efferocytosis     116429337  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116429337  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     116429337  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nmea04131]     116429337   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmea04147]     116429337    04031 GTP-binding proteins [BR:nmea04031]     116429337 Membrane trafficking [BR:nmea04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     116429337  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     116429337   Macropinocytosis    Ras GTPases     116429337  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     116429337 Exosome [BR:nmea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116429337   Exosomal proteins of other body fluids (saliva and urine)    116429337   Exosomal proteins of colorectal cancer cells    116429337   Exosomal proteins of bladder cancer cells    116429337 GTP-binding proteins [BR:nmea04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     116429337 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  116429337 NCBI-ProteinID:  XP_031838039 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLTMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRKCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccattaagtgcgttgttgtaggcgacggagccgtaggtaaaacatgccttctc ataagctacactaccaatgccttccccggggaatatattccaactgtgtttgacaattat tctgcgaacgttatggtggatggcaaaccgatcaatcttggtttatgggatacggcaggc caagaagattacgacagactgagaccattatcgtaccctcaaacagatgtctttttgatt tgtttttctttggtcaaccctgccagttttgaaaatgttcgtgctaagtggtatccagag gtgcgtcatcattgtccagctactccgatcattttagtagggactaaattagatttgcgc gaagacaaggaaaccatcgaacgattaaaagacaagaaattggcaccaattacatatcct cagggtttaacaatggcaaaagaaatcggagcagtgaagtatttagaatgttcggctttg actcaaaaaggattaaaaacagtattcgacgaagcaatccgtgcagtactgtgcccggtt ctccaagtgaaaccaaaacgcaaatgtttcctcctataa

DBGET integrated database retrieval system