KEGG   Nomia melanderi (Alkali bee): 116433559
Entry
116433559         CDS       T07404                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
nmea  Nomia melanderi (Alkali bee)
Pathway
nmea00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:nmea00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    116433559
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nmea00199]
    116433559
Enzymes [BR:nmea01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     116433559
Cytochrome P450 [BR:nmea00199]
 Cytochrome P450, animal type
  CYP306 family
   116433559
SSDB
Motif
Pfam: p450 RE_SinI
Other DBs
NCBI-GeneID: 116433559
NCBI-ProteinID: XP_031847622
LinkDB
Position
Unknown
AA seq 500 aa
MNLVYATFFVSLLFLAYLFDRSRRRRVRRLPPGPWQLPIVGYLPWIDAKKPHVSLTELVR
RYGPVCGVRMGSVYTVLLSDPRLIKQTFAQDACTGRAPLYLTHGIMQGYGLVCAEGDRWR
DQRKFVSSCLRNFGMVKHDGLKRDKMEGRILNAVDECVLKLEERSMNGPFDPMDTLHHCM
GNLVNSIVFGKTYEENDQVWKWLRHLQEEGVKHIGVAGPLNFLPLLRFLPRYGETIRSIM
DGKERTHRIYRGILEEYRSRSVTTTPSETENFLTAFEEQMRRENTTETSYYTEPQLYHLL
ADLFGAGTDTTLTTLRWFILFMAVYPEEQKKLQLEIDRSCSNEREGLHLADRASMPRLEA
ALAEVQRLRSVTPLGIPHGTLEDTRIGEYDVPRGAMIVPMQWAIHTDPIYWRDPLEYRPD
RFLAEDGSFFKPESFLPFQSGKRVCVGEELARMILFLFAGRILRSFDISVPLDETVDLEG
DSGITLVPKPHRLMFVRRRR
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaatcttgtttacgcaacgtttttcgtatctctccttttcctcgcgtaccttttcgat
agaagtcggaggaggagggtgcgtcgtctacctcctggcccttggcaacttccaatcgtt
ggctatcttccatggatcgacgcgaagaaacctcacgtatctctgacagaactggtcagg
agatatggccccgtctgtggagttcgcatgggttccgtttatactgtcctcctctcggat
cctcgactaataaagcagactttcgcgcaggatgcgtgtaccggcagggcaccattgtat
cttacgcacggaattatgcaaggatacgggctcgtttgcgccgagggagatcgttggaga
gatcaaaggaaattcgttagcagctgcttgagaaatttcggtatggtgaaacacgatggt
ttgaaacgtgacaaaatggagggaagaatcttgaatgccgtggacgaatgtgtattgaaa
ctcgaagagcgttcgatgaacggaccgttcgatccgatggatacgcttcatcactgtatg
ggcaatcttgtgaacagtatcgtctttgggaaaacgtacgaggaaaacgatcaagtttgg
aagtggttgaggcatttacaggaagagggagtgaagcatataggtgtcgctggaccatta
aattttctacctcttctcagattcttaccgcgatacggcgaaacgatacggtccattatg
gatgggaaggagaggactcatcgaatatatcgcggcatacttgaagaatatcgtagtcga
agcgttacgacaacaccttcggaaactgaaaactttttgactgcgttcgaggaacagatg
agaagggagaatactacggagactagttattacacggaacctcaactgtatcatttgttg
gctgacctgtttggtgctggaaccgacactaccttgacaactttgcgctggtttattctc
ttcatggctgtctatccggaagagcagaagaaactccagctggaaatagatcggagttgt
tcgaacgaaagggaagggttgcatttagcggatagagcctcgatgccgcgcctcgaagct
gccttggccgaagtgcaacgacttcgaagcgtcactcctttgggcattcctcatggaacg
ttggaggatacacggataggcgaatacgacgtgccgaggggcgcgatgattgtaccgatg
cagtgggctattcataccgatcccatttactggcgcgatcctctcgaatatcggcccgac
agatttctggcggaggatgggagtttctttaaaccggaatcgtttcttccgtttcagagc
gggaaacgcgtgtgcgttggcgaggaattagccagaatgatattatttcttttcgctggg
agaattctacgatcgttcgatatatcggtaccgttggacgaaaccgttgatctcgaaggc
gattccggcatcacgctagttccaaaacctcatcggttgatgttcgttaggagacgtcga
taa

DBGET integrated database retrieval system