Numida meleagris (helmeted guineafowl): 110388133 Help Entry 110388133         CDS       T06015                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04010   MAPK signaling pathway nmel04012   ErbB signaling pathway nmel04068   FoxO signaling pathway nmel04137   Mitophagy - animal nmel04140   Autophagy - animal nmel04150   mTOR signaling pathway nmel04210   Apoptosis nmel04218   Cellular senescence nmel04370   VEGF signaling pathway nmel04371   Apelin signaling pathway nmel04540   Gap junction nmel04625   C-type lectin receptor signaling pathway nmel04810   Regulation of actin cytoskeleton nmel04910   Insulin signaling pathway nmel04912   GnRH signaling pathway nmel04916   Melanogenesis Brite KEGG Orthology (KO) [BR:nmel00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110388133 (NRAS)    04012 ErbB signaling pathway     110388133 (NRAS)    04370 VEGF signaling pathway     110388133 (NRAS)    04371 Apelin signaling pathway     110388133 (NRAS)    04068 FoxO signaling pathway     110388133 (NRAS)    04150 mTOR signaling pathway     110388133 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110388133 (NRAS)    04137 Mitophagy - animal     110388133 (NRAS)   09143 Cell growth and death    04210 Apoptosis     110388133 (NRAS)    04218 Cellular senescence     110388133 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     110388133 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110388133 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110388133 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     110388133 (NRAS)    04912 GnRH signaling pathway     110388133 (NRAS)    04916 Melanogenesis     110388133 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nmel04131]     110388133 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmel04147]     110388133 (NRAS)    04031 GTP-binding proteins [BR:nmel04031]     110388133 (NRAS) Membrane trafficking [BR:nmel04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     110388133 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     110388133 (NRAS) Exosome [BR:nmel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110388133 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    110388133 (NRAS)   Exosomal proteins of breast cancer cells    110388133 (NRAS)   Exosomal proteins of colorectal cancer cells    110388133 (NRAS) GTP-binding proteins [BR:nmel04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110388133 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  110388133 NCBI-ProteinID:  XP_021232695 LinkDB All DBs Position 25:complement(4077581..4084100) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagctggcggcgtcgggaagagcgcgttgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggattcgtac agaaagcaggttgtcattgatggagagacgtgcttgttagatattctggacactgcagga caggaagaatacagtgctatgcgcgatcagtacatgagaactggggaaggattcctttgc gtgtttgccattaacaacagcaaatcatttgctgatattaacctttacagagagcaaatc aagagagtgaaagattcagacgatgtgccgatggtgctggttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaattccc ttcatagagacatcagctaaaacgagacagggtgtggaagatgcgttttacacgctggtg agagagattcggcagtaccggatgaaaaggctgaacagcaatgaagatgggaatcaaggc tgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system