Numida meleagris (helmeted guineafowl): 110388502 Help Entry 110388502         CDS       T06015                                  Symbol PPY Name (RefSeq) pancreatic prohormone   KO K05233   peptide YY Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04080   Neuroactive ligand-receptor interaction nmel04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:nmel00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     110388502 (PPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     110388502 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nmel04052]     110388502 (PPY) Cytokines and neuropeptides [BR:nmel04052]  Neuropeptides   GPCR binding    110388502 (PPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  110388502 NCBI-ProteinID:  XP_021233532 LinkDB All DBs Position 26:2045795..2047226 Genome browser AA seq 80 aa AA seqDB search MPPRWASLLLLACTLLLLSMPPAAAGPSQPTYPGDDAPVEDLVRFYNDLQQYLNVVTRHR YGRRSSSRVLCEEPMGTAGC NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgccccgctgggcctcgctgctgctgctggcctgcaccctgctgctgctctccatg cccccggccgccgccggcccctcgcagcccacctaccccggggatgatgctcccgtcgag gacctcgtccgcttctacaacgacctccagcagtacctcaacgtggtcacgcggcaccgg tacggccggcggtccagcagccgggtgctgtgtgaggagcccatgggcactgctgggtgc tga

DBGET integrated database retrieval system