Numida meleagris (helmeted guineafowl): 110390975 Help Entry 110390975         CDS       T06015                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism nmel  Numida meleagris (helmeted guineafowl) Brite KEGG Orthology (KO) [BR:nmel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nmel03036]     110390975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmel04147]     110390975 Chromosome and associated proteins [BR:nmel03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110390975 Exosome [BR:nmel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110390975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  110390975 NCBI-ProteinID:  XP_021238283 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccgtaccaagcagacggcccgcaagtccacgggcggtaaggcgccgcgcaagcag ctggccaccaaggcggcccggaagagcgctccgtccaccggcggcgtcaaaaagccgcac cgataccggcccggtacggtggcgctgagggagatccggcggtaccagaaatcgacggag ctgctgatccgtaaactgcccttccagcgcctggtgcgagagatcgcccaggacttcaag accgacctgcgcttccag

DBGET integrated database retrieval system