Numida meleagris (helmeted guineafowl): 110392216 Help Entry 110392216         CDS       T06015                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04020   Calcium signaling pathway nmel04070   Phosphatidylinositol signaling system nmel04114   Oocyte meiosis nmel04218   Cellular senescence nmel04261   Adrenergic signaling in cardiomyocytes nmel04270   Vascular smooth muscle contraction nmel04371   Apelin signaling pathway nmel04625   C-type lectin receptor signaling pathway nmel04744   Phototransduction nmel04910   Insulin signaling pathway nmel04912   GnRH signaling pathway nmel04916   Melanogenesis Brite KEGG Orthology (KO) [BR:nmel00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     110392216    04020 Calcium signaling pathway     110392216    04070 Phosphatidylinositol signaling system     110392216  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110392216    04218 Cellular senescence     110392216  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110392216   09152 Endocrine system    04910 Insulin signaling pathway     110392216    04912 GnRH signaling pathway     110392216    04916 Melanogenesis     110392216   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110392216    04270 Vascular smooth muscle contraction     110392216   09157 Sensory system    04744 Phototransduction     110392216  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nmel01009]     110392216   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nmel04131]     110392216    03036 Chromosome and associated proteins [BR:nmel03036]     110392216   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmel04147]     110392216 Protein phosphatases and associated proteins [BR:nmel01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110392216 Membrane trafficking [BR:nmel04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110392216 Chromosome and associated proteins [BR:nmel03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110392216 Exosome [BR:nmel04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110392216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen Dockerin_1 UPF0154 Caleosin DUF5580_M FCaBP_EF-hand SPEF2_C SurA_N_2 Fe_hyd_lg_C SurA_N_3 Motif Other DBs NCBI-GeneID:  110392216 NCBI-ProteinID:  XP_021239949 LinkDB All DBs Position 1:complement(1307250..1309347) Genome browser AA seq 149 aa AA seqDB search MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagcagatcgctgaattcaaggaggctttttcccttttc gatcgcgacggcgatggctgcatcaccacgaaggagctgggcaccgtcatgcgctcgctg gggcagaaccccaccgaggcggagctgcaggacatggtgggagaggtggacgctgacggc agcggcaccattgatttccccgagttcctctcattgatggcgaggaagatgagggactcg gacagcgaggaggagatccgcgaagctttccgtgtcttcgacaaggacggtaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag gaggtggacgagatgatcaaggaggcagattgcaacaacgacgggcaggtcaactacgag gagtttgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system