Numida meleagris (helmeted guineafowl): 110396062 Help Entry 110396062         CDS       T06015                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04810   Regulation of actin cytoskeleton nmel05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nmel00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110396062 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110396062 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nmel04131]     110396062 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nmel04812]     110396062 (PFN4)    04147 Exosome [BR:nmel04147]     110396062 (PFN4) Membrane trafficking [BR:nmel04131]  Others   Actin-binding proteins    Others     110396062 (PFN4) Cytoskeleton proteins [BR:nmel04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110396062 (PFN4) Exosome [BR:nmel04147]  Exosomal proteins   Proteins found in most exosomes    110396062 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110396062 NCBI-ProteinID:  XP_021247040 LinkDB All DBs Position 3:complement(105202166..105205492) Genome browser AA seq 129 aa AA seqDB search MSQLQALLNECLIRTKHVENAAAISISEREVCASTSGFYVPPENAINLTYAFYKNLLQVR KEGLYFKQKHYKCVRADEHSIYLKNADGGLIVVKTNAFILIATYRVGMYPSVCVEAVEKL ADYLREKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccagcttcaggctttgctgaatgaatgcctcatcagaacaaagcacgtggagaac gcagccgccatcagcataagcgagagggaagtctgcgcttcgacctctggcttctatgtg ccaccagagaatgctataaacctcacctatgctttctacaagaacttgctgcaagttaga aaggaaggactctacttcaagcagaagcactacaaatgtgttcgagcagacgagcattcc atctatcttaaaaatgcagacggaggcctcatagttgtgaagaccaatgctttcatcctg attgctacgtacagagtgggcatgtatcccagtgtgtgtgtggaagctgtggagaaactc gcagattacttaagagagaagggtagctga

DBGET integrated database retrieval system