Numida meleagris (helmeted guineafowl): 110400761 Help Entry 110400761         CDS       T06015                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04010   MAPK signaling pathway nmel04012   ErbB signaling pathway nmel04068   FoxO signaling pathway nmel04137   Mitophagy - animal nmel04140   Autophagy - animal nmel04144   Endocytosis nmel04150   mTOR signaling pathway nmel04210   Apoptosis nmel04218   Cellular senescence nmel04370   VEGF signaling pathway nmel04371   Apelin signaling pathway nmel04510   Focal adhesion nmel04540   Gap junction nmel04625   C-type lectin receptor signaling pathway nmel04810   Regulation of actin cytoskeleton nmel04910   Insulin signaling pathway nmel04912   GnRH signaling pathway nmel04916   Melanogenesis nmel05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nmel00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110400761 (HRAS)    04012 ErbB signaling pathway     110400761 (HRAS)    04370 VEGF signaling pathway     110400761 (HRAS)    04371 Apelin signaling pathway     110400761 (HRAS)    04068 FoxO signaling pathway     110400761 (HRAS)    04150 mTOR signaling pathway     110400761 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110400761 (HRAS)    04140 Autophagy - animal     110400761 (HRAS)    04137 Mitophagy - animal     110400761 (HRAS)   09143 Cell growth and death    04210 Apoptosis     110400761 (HRAS)    04218 Cellular senescence     110400761 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110400761 (HRAS)    04540 Gap junction     110400761 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110400761 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110400761 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     110400761 (HRAS)    04912 GnRH signaling pathway     110400761 (HRAS)    04916 Melanogenesis     110400761 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110400761 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nmel04131]     110400761 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmel04147]     110400761 (HRAS)    04031 GTP-binding proteins [BR:nmel04031]     110400761 (HRAS) Membrane trafficking [BR:nmel04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     110400761 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     110400761 (HRAS) Exosome [BR:nmel04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110400761 (HRAS)   Exosomal proteins of colorectal cancer cells    110400761 (HRAS) GTP-binding proteins [BR:nmel04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110400761 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  110400761 NCBI-ProteinID:  XP_021256601 LinkDB All DBs Position 6:16200656..16234150 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtagtgggagctggaggtgtcgggaagagcgctttgacg atacaactcattcagaaccattttgttgatgagtacgaccccacaatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgtttgctggacatcctggatacggcgggg caagaggagtacagtgccatgcgagaccagtacatgagaacgggggagggattcctgtgc gtctttgccattaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctg ccagcacggacagtggagacccggcaagcgcaggacctggcccggagttatgggatcccc tacatagaaacgtcagccaaaaccagacagggcgttgaagatgccttctataccttagtg cgggagatccgtcagcataaactgcgcaagctgaacccaccagatgagagcggccctggc tgcatgaactgtaaatgcgtgatatcatga

DBGET integrated database retrieval system