KEGG   Numida meleagris (helmeted guineafowl): 110402330
Entry
110402330         CDS       T06015                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
nmel  Numida meleagris (helmeted guineafowl)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 110402330
NCBI-ProteinID: XP_021259981
LinkDB
Position
1:102863075..102880833
AA seq 120 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGRKLKVNKYSIVIAFWVGLAAFVMFLFLILLCM
SRSGSNPVKQVVVRNQVEESSSNSEQPHCDNLSSPFPDLVAPGTPSCLPDETGIHGSVSA
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccaacagaacaaactcatctgagtacttctggtcttatgaatattattgggattac
atagatccaattccagtagatggaaggaagttgaaagttaataaatattctattgttata
gccttttgggttggacttgctgcctttgtgatgtttcttttccttattttgctctgtatg
tcccgctctggatcaaatccagtaaaacaggtggtcgtaaggaaccaggtagaagaaagc
agttccaacagcgagcagcctcactgcgacaacctcagtagtccattcccagatctggtt
gctcctggaacacccagctgtcttccagatgaaactggcattcatggaagtgtctcagcc
tga

DBGET integrated database retrieval system