Nocardioides mesophilus: H9L09_02000 Help Entry H9L09_02000       CDS       T07004                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nmes  Nocardioides mesophilus Pathway nmes01100   Metabolic pathways nmes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L09_02000    00074 Mycolic acid biosynthesis     H9L09_02000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L09_02000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QNN54769 UniProt:  A0A7G9RGP4 LinkDB All DBs Position 439456..439707 Genome browser AA seq 83 aa AA seqDB search MMASTEEIRADLADIVNEVAGVPAEDVQLDKSFVDDLDVDSLSMVEVVVAAEEKFDVKIP DDEVKNLKTVGDAVAFIERAQNG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ctgatggccagcaccgaggaaatccgcgcagatctcgccgacatcgtcaacgaggtcgcc ggcgtccccgccgaggacgtccagctcgacaagtcgttcgtggacgacctggacgtcgac tcgctgtcgatggtcgaggtcgtcgtcgccgccgaggagaagttcgacgtcaagatcccc gacgacgaggtcaagaacctcaagaccgtcggtgacgccgtcgcgttcatcgagcgcgcg cagaacggctga

DBGET integrated database retrieval system