Nonlabens marinus: NMS_0120 Help Entry NMS_0120          CDS       T09770                                  Name (GenBank) beta-carotene hydroxylase   KO K15746   beta-carotene 3-hydroxylase [EC:1.14.15.24] Organism nmf  Nonlabens marinus Pathway nmf00906   Carotenoid biosynthesis nmf01100   Metabolic pathways nmf01110   Biosynthesis of secondary metabolites Module nmf_M01045   Zeaxanthin biosynthesis, lycopene => beta-carotene => zeaxanthin Brite KEGG Orthology (KO) [BR:nmf00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    00906 Carotenoid biosynthesis     NMS_0120 Enzymes [BR:nmf01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor     1.14.15.24  beta-carotene 3-hydroxylase      NMS_0120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FA_hydroxylase Aa_trans OmpA_membrane Motif Other DBs NCBI-ProteinID:  BAO54129 UniProt:  W8VMY7 LinkDB All DBs Position 123062..123424 Genome browser AA seq 120 aa AA seqDB search MHGFLWNLHEDHHHKTHDSWFEKNDWFFVFFASISITFKLLHSFLDLWWALPISAGIFAY GVAYFVVHDIFIHQRFKWLRKANNTYAKGVRRAHKIHHKHLGKGDGENFGMLIVPLKYFK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgcacggttttctatggaatttgcatgaagaccaccatcacaaaacccacgacagttgg tttgaaaaaaacgattggttttttgttttttttgcgagtattagcatcacatttaaatta ttacacagctttttagacctgtggtgggcattgcctatcagtgctggaatatttgcatat ggtgttgcgtactttgtggtacacgatatttttattcaccaacgctttaaatggctgcgt aaagcgaacaatacttatgcaaaaggcgtgagacgcgctcacaagatccatcacaagcac ttaggtaaaggcgatggggagaactttggtatgttgatcgtaccattgaaatactttaaa taa

DBGET integrated database retrieval system