Nonlabens marinus: NMS_2316 Help Entry NMS_2316          CDS       T09770                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nmf  Nonlabens marinus Pathway nmf01100   Metabolic pathways nmf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NMS_2316    00074 Mycolic acid biosynthesis     NMS_2316   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NMS_2316 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 APC1_3rd CandA_N Motif Other DBs NCBI-ProteinID:  BAO56325 UniProt:  W8VSM2 LinkDB All DBs Position 2413512..2413760 Genome browser AA seq 82 aa AA seqDB search MTHTEIQERLFKIVKVYLPQDVDATAIKPESHLMNDLNINSAHLVDVALDVEDAFDIVLN EKDMEEMQTVSDAVRIVQAKTS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccatacagaaattcaagagcgacttttcaaaattgtaaaagtgtatttaccacaa gatgtagatgcaactgccatcaagcctgaaagtcatttaatgaacgatttgaatataaac agtgcgcacctggtagatgtggcactagatgttgaagatgcttttgacatcgtattgaat gaaaaagatatggaagaaatgcaaaccgtctctgatgcagttcgcattgttcaagcaaaa acaagctaa

DBGET integrated database retrieval system