Nonlabens marinus: NMS_2737 Help Entry NMS_2737          CDS       T09770                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism nmf  Nonlabens marinus Pathway nmf01100   Metabolic pathways nmf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NMS_2737    00074 Mycolic acid biosynthesis     NMS_2737   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NMS_2737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Alpha-amylase Motif Other DBs NCBI-ProteinID:  BAO56746 UniProt:  W8W0Q7 LinkDB All DBs Position complement(2851247..2851471) Genome browser AA seq 74 aa AA seqDB search MEEKLISIFNTVREGSGLGDLTTINDQMDLRKDIGFDSFNLAELTVHVEEEFGVDIFEDG IVNTVGEIKAKLNS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaagaaaaattaatttcaatattcaatactgtaagagaagggtcagggcttggagac ctaaccactattaatgatcaaatggaccttcggaaagatattggattcgactcctttaat cttgctgaacttaccgttcatgtagaagaagaatttggagttgacatttttgaggatggt attgtaaatacggttggtgaaattaaggcaaagctaaactcttaa

DBGET integrated database retrieval system