Natrialba magadii: Nmag_1272 Help Entry Nmag_1272         CDS       T01176                                  Symbol rps31e Name (GenBank) 30S ribosomal protein S31e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nmg  Natrialba magadii Pathway nmg03010   Ribosome Brite KEGG Orthology (KO) [BR:nmg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Nmag_1272 (rps31e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Nmag_1272 (rps31e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nmg03011]     Nmag_1272 (rps31e)    04121 Ubiquitin system [BR:nmg04121]     Nmag_1272 (rps31e)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmg04147]     Nmag_1272 (rps31e) Ribosome [BR:nmg03011]  Ribosomal proteins   Eukaryotes    Small subunit     Nmag_1272 (rps31e)   Archaea     Nmag_1272 (rps31e) Ubiquitin system [BR:nmg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Nmag_1272 (rps31e) Exosome [BR:nmg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Nmag_1272 (rps31e)   Exosomal proteins of colorectal cancer cells    Nmag_1272 (rps31e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 FYVE Ribosomal_L37e Zn_Ribbon_TF Zn_ribbon_3 Cas12f1-like_TNB DUF7479 zf-C2H2_FBX41 Zn_ribbon_TFIIB Motif Other DBs NCBI-ProteinID:  ADD04852 UniProt:  D3SSC6 LinkDB All DBs Position 1301574..1301708 Genome browser AA seq 44 aa AA seqDB search MARYELYGDDGTTEGDQCPRCGDVFLADHGDRKHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgctacgaactctacggcgacgacggcaccaccgaaggcgaccagtgcccccgc tgtggcgacgtcttcctcgccgaccacggcgaccgcaagcactgtggcaagtgcggctac accgagtgggagtaa

DBGET integrated database retrieval system