Natronomonas moolapensis: Nmlp_1552 Help Entry Nmlp_1552         CDS       T02478                                  Symbol rps31e Name (GenBank) 30S ribosomal protein S31e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nmo  Natronomonas moolapensis Pathway nmo03010   Ribosome Brite KEGG Orthology (KO) [BR:nmo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Nmlp_1552 (rps31e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Nmlp_1552 (rps31e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nmo03011]     Nmlp_1552 (rps31e)    04121 Ubiquitin system [BR:nmo04121]     Nmlp_1552 (rps31e)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nmo04147]     Nmlp_1552 (rps31e) Ribosome [BR:nmo03011]  Ribosomal proteins   Eukaryotes    Small subunit     Nmlp_1552 (rps31e)   Archaea     Nmlp_1552 (rps31e) Ubiquitin system [BR:nmo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Nmlp_1552 (rps31e) Exosome [BR:nmo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Nmlp_1552 (rps31e)   Exosomal proteins of colorectal cancer cells    Nmlp_1552 (rps31e) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 FYVE Rcat_RNF216 Zn_ribbon_RPB9 Phage_zn_bind_3 Zn_ribbon_19 Cas12f1-like_TNB zf-C2H2_FBX41 RNHCP Zn_ribbon_16 Zn_ribbon_NOB1 zf-C2H2_ZN142 Motif Other DBs NCBI-ProteinID:  CCQ35752 UniProt:  M1XP49 LinkDB All DBs Position complement(536440..536574) Genome browser AA seq 44 aa AA seqDB search MARYELYNEDGTTDREHCPRCGDTFLGEYGDRKHCGQCGYTEFE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgttacgaactctacaacgaggacggtacgacggaccgcgagcactgtccccgc tgtggcgacacgtttctcggagagtacggcgaccggaagcactgcgggcagtgcggctac accgaattcgagtag

DBGET integrated database retrieval system