Nitrosopumilus maritimus: Nmar_1125 Help Entry Nmar_1125         CDS       T00626                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nmr  Nitrosopumilus maritimus Pathway nmr03010   Ribosome Brite KEGG Orthology (KO) [BR:nmr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Nmar_1125   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Nmar_1125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nmr03011]     Nmar_1125    04121 Ubiquitin system [BR:nmr04121]     Nmar_1125 Ribosome [BR:nmr03011]  Ribosomal proteins   Eukaryotes    Large subunit     Nmar_1125   Archaea     Nmar_1125 Ubiquitin system [BR:nmr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Nmar_1125 SSDB OrthologParalogGFIT Motif Pfam:  DUF7577 Ribosomal_L40e DZR Ribosomal_aS21 Zn_Ribbon_1 zf-tcix Zn_ribbon_3 DUF8122 Motif Other DBs NCBI-ProteinID:  ABX13021 UniProt:  A9A4P3 LinkDB All DBs Position 1029001..1029168 Genome browser AA seq 55 aa AA seqDB search MPITDPEKKRIAQQARLVMRICFNCGARNDVGATRCRKCRNPYLRLKNRNLGVKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgccaatcacagacccagaaaagaaacgaattgcacagcaagctagacttgtcatgaga atttgttttaattgtggggcacgaaacgatgttggcgctactagatgcagaaaatgcaga aacccatacttgagattaaagaacagaaatctcggcgtaaagaaatag

DBGET integrated database retrieval system