Nitrosospira multiformis: Nmul_A0275 Help Entry Nmul_A0275        CDS       T00302                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism nmu  Nitrosospira multiformis Pathway nmu01100   Metabolic pathways nmu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Nmul_A0275    00074 Mycolic acid biosynthesis     Nmul_A0275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Nmul_A0275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABB73583 UniProt:  Q2YCD8 LinkDB All DBs Position complement(296228..296479) Genome browser AA seq 83 aa AA seqDB search MQHIEEVRNILSDVLSLGERRNSLNADSPLLGAIPELDSMAVVNVITALEDHFDITVDDD EISAKTFETVGSLTQFVEQKLAE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcagcatattgaagaagtgagaaacatcctatctgacgtattgagcctcggggaaaga agaaattcgctcaatgcggattcccccttgcttggggccattcccgaactggattcaatg gctgtcgtcaatgtaatcaccgctctcgaggaccacttcgacatcacggttgacgatgat gagatcagtgcaaaaactttcgaaactgtcggcagcctgacccaattcgtcgagcagaag ctggcggaatga

DBGET integrated database retrieval system