Neisseria musculi: H7A79_0040 Help Entry H7A79_0040        CDS       T07094                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nmus  Neisseria musculi Pathway nmus01100   Metabolic pathways nmus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nmus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7A79_0040 (acpP)    00074 Mycolic acid biosynthesis     H7A79_0040 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7A79_0040 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QNT59069 UniProt:  A0A7H1MBQ4 LinkDB All DBs Position complement(47604..47840) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYIQSHSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacattgaacaacaagttaaaaaaattgttgccgaacaactgggtgtaaacgaa gccgaagtgaaaaacgagtcttctttccaagacgacttgggtgccgactcactcgacacc gttgagctggttatggcactggaagaagctttcggctgcgaaatccccgatgaagaagcc gaaaaaatcaccaccgtgcaactggctatcgactatatccaatcacactccgcctaa

DBGET integrated database retrieval system